Independent Lab Verified|≥98% Purity Guarantee|Shipped Within 24hrs|Batch-Specific COAs|International Shipping|North American Made|Free Shipping $149 USD+|New: Research Bundles Available|Independent Lab Verified|≥98% Purity Guarantee|Shipped Within 24hrs|Batch-Specific COAs|International Shipping|North American Made|Free Shipping $149 USD+|New: Research Bundles Available|Independent Lab Verified|≥98% Purity Guarantee|Shipped Within 24hrs|Batch-Specific COAs|International Shipping|North American Made|Free Shipping $149 USD+|New: Research Bundles Available|Independent Lab Verified|≥98% Purity Guarantee|Shipped Within 24hrs|Batch-Specific COAs|International Shipping|North American Made|Free Shipping $149 USD+|New: Research Bundles Available|
effect collection

Anti Inflammatory Research Peptides

27 peptides with demonstrated anti inflammatory effects in research. Sorted by evidence quality from strongest to exploratory.

Overview

27 research peptides demonstrate anti inflammatory properties. This collection covers their mechanisms, evidence base, and research applications.

BPC-157

Phase I–II Clinical Trials | Healing & Recovery

BPC-157 is a synthetic 15-amino-acid peptide (sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val, MW ~1419.5 g/mol) derived from a protein found in human gastric juice.

Mechanism: BPC-157 acts through multiple overlapping pathways. It promotes angiogenesis by upregulating VEGFR2 and VEGF expression, and activates nitric oxide synthesis via the Src kinase-caveolin-1 pathway and...

TB-500

Preclinical | Healing & Recovery

TB-500 is a synthetic fragment of thymosin beta-4 (Tβ4), a naturally occurring 43-amino-acid peptide found throughout human tissues.

Mechanism: TB-500 works primarily through actin sequestration — it binds to G-actin monomers, preventing premature polymerization, which allows repair cells to migrate rapidly to injured areas.

GHK-Cu

No Regulatory Activity | Skin & Tissue Repair

GHK-Cu is a naturally occurring copper-binding tripeptide (glycyl-L-histidyl-L-lysine) found in human plasma, saliva, and urine. First discovered by Dr.

Mechanism: GHK-Cu chelates copper(II) ions via its histidine residue and delivers bioavailable copper directly to cells, preventing free copper oxidative damage.

LL-37

Preclinical | Antimicrobial / Immune

LL-37 is the only human cathelicidin antimicrobial peptide, a 37-amino-acid cationic peptide (sequence: [LL-37, 37 aa]) with broad-spectrum antimicrobial activity against Gram-positive and Gram-negative bacteria, fungi,...

Mechanism: LL-37 (C120H232N42O38) carries a net positive charge (+6) that binds negatively charged bacterial membranes, creating transmembrane pores causing cell lysis. It also has anti-biofilm activity.

Thymosin Alpha-1

Phase I–II Clinical Trials | Immune Modulator

Thymosin alpha-1 (Ta1) is a clinically proven, 28-amino-acid peptide (MW ~3,108 g/mol, Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH) naturally produced by the thymus gland.

Mechanism: Ta1 (C129H215N33O55) activates Toll-like Receptors TLR2 and TLR9 on immune cells, triggering the MyD88 and NF-kB signaling pathways to put the immune system on alert without destructive inflammation.

Semax

Preclinical | Nootropic / Neuroprotective

Semax is a synthetic heptapeptide (Met-Glu-His-Phe-Pro-Gly-Pro) derived from adrenocorticotropic hormone (ACTH) fragment 4-10, with an added Pro-Gly-Pro sequence for metabolic stability. Molecular weight is approximately 813.

Mechanism: Semax is a brain-selective heptapeptide (Met-Glu-His-Phe-Pro-Gly-Pro, MW ~813.88 g/mol) that crosses the blood-brain barrier via intranasal absorption.

KPV

Preclinical | Anti-Inflammatory / Immune

KPV is a naturally occurring tripeptide (Lys-Pro-Val, MW ~342.4 g/mol) derived from the C-terminal region (positions 11–13) of alpha-melanocyte-stimulating hormone (α-MSH).

Mechanism: KPV exerts anti-inflammatory effects through a mechanism distinct from the parent α-MSH hormone. Rather than acting through melanocortin receptors (which would trigger pigmentation), KPV is...

ARA-290 (Cibinetide)

Phase I–II Clinical Trials | Tissue Repair / Neuropathic Pain

ARA-290 (cibinetide) is a synthetic 11-amino-acid peptide (MW ~1257 g/mol) derived from the helix B surface of erythropoietin (EPO).

Mechanism: ARA-290 selectively binds the innate repair receptor (IRR), a heteromeric complex of the erythropoietin receptor (EPOR) and β-common receptor (CD131/βcR).

Thymosin Beta-4

Phase III / NDA Filed | Healing & Recovery

Thymosin beta-4 (Tβ4) is a naturally occurring 43-amino acid protein found in virtually all human and animal cells. It is the most abundant member of the beta-thymosin family and plays fundamental roles in cell migration, wound healing, and tissue...

Mechanism: Thymosin beta-4 is the primary intracellular G-actin sequestering protein, maintaining actin monomer pools and regulating cytoskeletal dynamics essential for cell migration.

Larazotide

Phase III / NDA Filed | Healing & Recovery

Larazotide (AT-1001) is a synthetic 8-amino acid peptide that acts as a tight junction regulator. It is being developed as an oral adjunct therapy for celiac disease, designed to reduce intestinal permeability ("leaky gut") triggered by gluten...

Mechanism: Larazotide acts as a zonulin antagonist, blocking the zonulin pathway that opens tight junctions in the intestinal epithelium.

Palmitoyl Tetrapeptide-7

No Regulatory Activity | Cosmetic Peptide

Palmitoyl tetrapeptide-7 (Pal-GQPR) is a lipopeptide used in cosmetic anti-aging formulations. It is designed to reduce skin inflammation by inhibiting IL-6 secretion, targeting "inflammaging" — the chronic low-grade inflammation that contributes to...

Mechanism: Palmitoyl tetrapeptide-7 reduces the secretion of interleukin-6 (IL-6) from keratinocytes and other skin cells.

Thymulin

Early Clinical / Preclinical | Immune Modulator

Thymulin (FTS) is a 9-amino-acid zinc metallopeptide (sequence: pyroGlu-Ala-Lys-Ser-Gln-Gly-Gly-Ser-Asn, MW ~858 g/mol) secreted exclusively by thymic epithelial cells.

Mechanism: Thymulin binds zinc in a 1:1 stoichiometric ratio, which is required for its active conformation and receptor binding.

Omiganan

Phase III (Not Approved) | Antimicrobial / Immune

Omiganan (MBI 226) is a 12-amino-acid synthetic cationic antimicrobial peptide (sequence: ILRWPWWPWRRK-NH2, MW ~1779 g/mol) derived from indolicidin, a natural antimicrobial peptide from bovine neutrophils.

Mechanism: Omiganan is a tryptophan- and arginine-rich cationic peptide that disrupts microbial cell membranes through electrostatic and hydrophobic interactions.

Brilacidin

Phase II Clinical Trials | Antimicrobial / Immune

Brilacidin (PMX-30063) is a synthetic small-molecule defensin-mimetic (MW ~564 g/mol) developed by Innovation Pharmaceuticals (formerly Cellceutix).

Mechanism: Brilacidin is an arylamide foldamer that mimics the cationic amphipathic structure of natural defensins.

VIP (Vasoactive Intestinal Peptide)

Phase II/III Clinical Trials | Neuropeptide / Reference

Vasoactive Intestinal Peptide (VIP) is a 28-amino-acid neuropeptide (MW ~3326.8 g/mol) widely distributed in the central and peripheral nervous systems, lungs, and gastrointestinal tract.

Mechanism: VIP binds with high affinity to VPAC1 and VPAC2 receptors (Gs-coupled GPCRs), activating adenylyl cyclase and increasing intracellular cAMP.

Related Products

GHK-Cu 50mg
In Stock

GHK-Cu 50mg

50mg

$24 USD
Tesamorelin 10mg
In Stock

Tesamorelin 10mg

10mg

$64 USD
BPC-157 5mg
In Stock

BPC-157 5mg

5mg

$34 USD
BPC-157 10mg
In Stock

BPC-157 10mg

10mg

$44 USD
Ipamorelin 10mg
In Stock

Ipamorelin 10mg

10mg

$49 USD
CJC-1295 No DAC + Ipamorelin 10mg (5+5)
In Stock

CJC-1295 No DAC + Ipamorelin 10mg (5+5)

10mg

$49 USD

Frequently Asked Questions

Explore More

Research Use Only. The information on this page is compiled from published research literature and is provided for educational purposes only. It does not constitute medical advice. All compounds referenced are intended for in vitro research use by qualified laboratories and institutions.

Your Cart

Your cart is empty

Browse our catalog to add research compounds.